PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_23360V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 1290aa    MW: 140601 Da    PI: 6.7798
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_23360V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-16567613148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT+eEd  lv++v+++G  +W++Ia  +  gR +kqc++rw+++l
  Pp3c6_23360V3.3.p 567 KGQWTPEEDRYLVELVERHGQQRWSLIATQLT-GRIGKQCRERWHNHL 613
                        799****************************9.*************97 PP

2Myb_DNA-binding54.42.9e-17619661145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        r+ W teE+e lv a+++lG++ W+ Ia++++ gRt++ +k++w+
  Pp3c6_23360V3.3.p 619 RDGWNTEEEEALVSAHNKLGNR-WADIAKMIP-GRTENAIKNHWN 661
                        567*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.608562617IPR017930Myb domain
SuperFamilySSF466891.05E-29564660IPR009057Homeodomain-like
SMARTSM007175.8E-16566615IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-27568619IPR009057Homeodomain-like
PfamPF139213.0E-18570630No hitNo description
CDDcd001676.03E-14570613No hitNo description
PROSITE profilePS5129419.42618668IPR017930Myb domain
SMARTSM007178.7E-16618666IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-20620667IPR009057Homeodomain-like
CDDcd001677.06E-12622661No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006777Biological ProcessMo-molybdopterin cofactor biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1290 aa     Download sequence    Send to blast
MTLKETHGML KNSAPSPSGP LSPRVGSALS PGGPYTVDIR MQLSVGDTKA SGSSTNVVAA  60
TALGGSSKVA ALNNLPSTGS SLQNQSLNRL QHPSLGDGAP TTRQQHDETT SNFPTFHEMG  120
STAVNVSQQR QQASSYTLQS HEQHENTSGK GLMYNISDKT SPGWRGRRTR EWSGDFQERS  180
SQVTSENWAS PRSADGDEPT SLHFQDQWSN RKDLHLSAAN QSCAPATLCS KRARVSKLLC  240
HPRQDSGCLT TSPPTSPSQD ESATNSSNMW ESLFQRSHIM QSSKPGAFAT GKQTEAGSTS  300
TEGHRSIQLD ATNVQMDLGD ESMVAKIQAG EARNDLPASM TTCSEEHLKR FQEAQRNIEL  360
QQTNSGTIAG GGIRFESSPN NLLSDVITDT LRSRELPNQQ IGSSSGYLGS TTYSAIDGWP  420
QEGGSVTDYL LLTSAVHKAN LLDLQIQENQ RNLKQGILNC CSDEYMSGSR PTDTVDYQTG  480
LRMGSNGVSL EENGSPFCYS SLSMLPGHEF SVTNDFFMDS RCNPGEQLTA RAAYEKTRNE  540
QRGDCLPSKR VFKRSSKGGP RRPHIIKGQW TPEEDRYLVE LVERHGQQRW SLIATQLTGR  600
IGKQCRERWH NHLRPDIKRD GWNTEEEEAL VSAHNKLGNR WADIAKMIPG RTENAIKNHW  660
NATMRRKDLR RKHRRVADGS SDGLEVVPRC TILRDYQQKV VAQGGGRKGR VFKSLPTVDD  720
VDRFNKGNPD DTHSGTPESD SPQLTCGSPP GWTSNEIEKL TLPARIVEMN STPEPDHTIM  780
NNKMGRKDLQ EEVEGTRAST QYVNPLAHGN LISLVQSVGY GASSVSSANP LQSRVSVWGQ  840
GVGSYSRPPV TFWGGGQWAE GGSEVLFAEP AATGKAEDDD AAIWVSQNNV PDYGSTSRFS  900
DAATSDAVPV YQSSELRDLK ATDHITASQL GTLDQIVNDS SRNSNNHPHL LPYSLERGSA  960
SSQSKGMLQQ GRNKFSNLDL STQAYSSLDG SARPLHGHSH FQATDELEQQ LESTSGAAGS  1020
VASLERKGIL TTGDNELAQA DRIGNNTREN PRALSTNPDI ILAAASAAAS DHCRYHPNAN  1080
PLAIVEPSVK RTVTIPNHQL SVNSFENANA NHDPRLSAYF GNPCHDTFNP HRQQVMNYVT  1140
GGPDHDISDV TSLLLSRGPM SSLADDITSV TSESTTFSNS SPLGRKYWDQ SPSHSSPSRG  1200
PGDLDLVELV AQPLDQAHYL RKVKHPACSE SLGVSTSVCT VPTVTENGRD IRGINFHSHT  1260
YHEAEAKLYD ICSKMRSQWQ LGCIALAHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-4456366754158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4456366754158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-445656672104C-Myb DNA-Binding Domain
1msf_C1e-445656672104C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S103_56V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-48myb domain protein 119